PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c15_15960V3.2.p
Common NamePHYPADRAFT_100368, PP2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family MYB
Protein Properties Length: 422aa    MW: 46695.4 Da    PI: 6.5953
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c15_15960V3.2.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.97.4e-161461148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        rg+WT eEd++lv  ++  G  +W++I++  g+ R++k+c++rw +yl
  Pp3c15_15960V3.2.p 14 RGPWTSEEDQKLVSHITNNGLSCWRAIPKLAGLLRCGKSCRLRWTNYL 61
                        89******************************99************97 PP

2Myb_DNA-binding48.12.8e-1567110146
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                         rg +++ E+ l++d+++ lG++ W++Ia+ ++ gRt++++k++w++
  Pp3c15_15960V3.2.p  67 RGIFSEAEENLILDLHATLGNR-WSRIAAQLP-GRTDNEIKNYWNT 110
                         6789******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.1E-21564IPR009057Homeodomain-like
PROSITE profilePS5129414.346961IPR017930Myb domain
SuperFamilySSF466895.24E-2711108IPR009057Homeodomain-like
SMARTSM007176.1E-111363IPR001005SANT/Myb domain
PfamPF002492.2E-131461IPR001005SANT/Myb domain
CDDcd001674.49E-91661No hitNo description
PROSITE profilePS5129424.36962116IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.4E-2565116IPR009057Homeodomain-like
SMARTSM007173.4E-1566114IPR001005SANT/Myb domain
PfamPF002498.4E-1467110IPR001005SANT/Myb domain
CDDcd001671.34E-1170112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0030018anatomygametophore
Sequence ? help Back to Top
Protein Sequence    Length: 422 aa     Download sequence    Send to blast
MGRKPCCEKV GLRRGPWTSE EDQKLVSHIT NNGLSCWRAI PKLAGLLRCG KSCRLRWTNY  60
LRPDLKRGIF SEAEENLILD LHATLGNRWS RIAAQLPGRT DNEIKNYWNT RLKKRLRSQG  120
LDPNTHLPLE DSKLDDTEDD TDDEGGDSSD VTMSDASKSE KRSKKKSKPK ETVKVRQPKG  180
PKPAPQLKMC QSDEGPVLLK VPKAPKSPIS VNPGPGCNYD DDSEHSSSST VTTKSHEDHR  240
DSSDFIKALT SVSSFPEAEL WSCIKPITNS FSSTALLSEW DSYRAFDSSL FPSSYPQLNS  300
GLPKLEDVNS KSSAVASPVQ GMLPAYNPMG MEMQTRMQFS SQLTHEIGQN YGGIFQETCY  360
PQPDMGMSWS MHAELSHCGT ESLFATPNPA NAPSNFEEVP QPSPCTTSQE LQRLAALLDL  420
I*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-27121165108B-MYB
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1110116RLKKRLR
2111117LKKRLRS
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ppa.490.0gametophore
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: High rates of growth.
Functional Description ? help Back to Top
Source Description
UniProtPossible transcription activator.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankX670500.0X67050.1 P.patens mRNA Pp2.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_001784732.10.0predicted protein
SwissprotP800730.0MYB2_PHYPA; Myb-related protein Pp2
TrEMBLA9SH570.0A9SH57_PHYPA; Predicted protein
STRINGPP1S420_4V6.10.0(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66230.13e-69myb domain protein 20
Publications ? help Back to Top
  1. Rensing SA, et al.
    The Physcomitrella genome reveals evolutionary insights into the conquest of land by plants.
    Science, 2008. 319(5859): p. 64-9
    [PMID:18079367]
  2. Leech MJ,Kammerer W,Cove DJ,Martin C,Wang TL
    Expression of myb-related genes in the moss, Physcomitrella patens.
    Plant J., 1993. 3(1): p. 51-61
    [PMID:8401607]